We read every piece of feedback, and take your input very seriously.
To see all available qualifiers, see our documentation.
Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.
By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.
Already on GitHub? Sign in to your account
I got this error when there was an X in a protein sequence
File "/Users/guzmanfj/Documents/py/CoolerCodonOpt/scripts/codonopt.py", line 482, in opt_backtranslate codons = codons_probabilities[aa][0] KeyError: 'X'
Input sequence:
>118 MFVEVPPENAIXTYYATSVLIIQIQDFYTPLNPANMLTLQQVIREPRDIRLTPRLDVQAQ PKVWPS
The text was updated successfully, but these errors were encountered:
No branches or pull requests
I got this error when there was an X in a protein sequence
Input sequence:
The text was updated successfully, but these errors were encountered: