Skip to content
New issue

Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.

Sign up for GitHub

By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.

Already on GitHub? Sign in to your account

Jump to bottom

Predict MS2 spectrum of a peptide with a modification in a particular position #15

Open
lgatto opened this issue Dec 29, 2023 · 0 comments
Open

Predict MS2 spectrum of a peptide with a modification in a particular position #15

lgatto opened this issue Dec 29, 2023 · 0 comments

Comments

@lgatto
Copy link
Member

lgatto commented Dec 29, 2023

I have a sequence:

"ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE"

it contans many Lys, but I want to add a modification (acetylation 42Da to only the second Lys). Based on the calculateFragments() documentation it appears I can only add modifications to all residues of a particular type (all Lys). Is there an implementation that can solve my problem?

Copied over from MSnbase.
Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment
Assignees
No one assigned
Labels
None yet
Projects
None yet
Milestone
No milestone
Development

No branches or pull requests
1 participant
@lgatto