PMGen (Peptide-MHC Predictive, Modeling and Generative) is a powerful and flexible framework for Peptide-MHC (pMHC) complex modeling, binding prediction, and neoantigen design. It integrates cutting-edge tools such as PANDORA for template generation, AlphaFold (via AFfine) for structural prediction, and ProteinMPNN for sequence design, enabling researchers to model pMHC complexes, predict binding interactions, and engineer novel peptide or MHC sequences.
- Structural Modeling: Generate accurate 3D models of pMHC complexes using PANDORA and AlphaFold.
- Binding Prediction: Predict peptide-MHC binding affinities and anchor positions.
- Protein Design: Design new peptide sequences, full MHC sequences, or MHC pseudo-sequences using ProteinMPNN.
- Batch Processing: Process multiple pMHC complexes efficiently with parallel execution support.
- Customizable Workflow: Options to skip steps (e.g., AlphaFold) or focus on specific tasks (e.g., ProteinMPNN only).
Requirements:
Python 3.8+
Conda or Mamba
CUDA-enabled GPU (required for AlphaFold)
Modeller (requires a license key)
Git
Follow these steps to set up PMGen on your system:
- Clone the Repository:
git clone https://github.com/soedinglab/PMGen.git cd PMGen bash -l install.sh conda activate PMGen
You will be prompted to enter your Modeller license key (required for PANDORA). The script creates a Conda environment (PMGen), installs dependencies, clones PANDORA and ProteinMPNN, and sets up necessary configurations.
- Customize setting file (Optional but Recommended):
Install netMHCpan's latest version.
Edit
user_setting.pyto adjust netMHCpan and netMHCIIpan installation paths.
PMGen operates in two primary modes:
modeling: For modeling a single pMHC complex.
wrapper: For batch processing multiple complexes from a TSV file.
Run the tool with the main script:
bash
python run_PMGen.py [options]
Command-Line Options
General Options
--run [parallel|single]: Execution mode (default: parallel). Note: parallel is only for --mode wrapper.
--mode [wrapper|modeling]: Operation mode (default: wrapper).
--output_dir <path>: Directory for output files (required).
Modeling Mode Options
--peptide <sequence>: Peptide sequence (e.g., SIINFEKL).
--mhc_seq <sequence>: MHC sequence (MHC-I: single chain; MHC-II: chain_A/chain_B).
--mhc_fasta <file>: FASTA file with MHC sequence(s).
--mhc_allele <allele>: MHC allele (e.g., HLA-A*02:01, optional).
--mhc_type [1|2]: MHC class (1 for MHC-I, 2 for MHC-II).
--id <identifier>: Unique identifier for the run.
--anchors <positions>: Anchor positions (e.g., [2,9] for MHC-I).
--predict_anchor: Predict anchor positions (recommended if --anchors is omitted).
Wrapper Mode Options
--df <file.tsv>: TSV file with pMHC data (columns: peptide, mhc_seq, mhc_type, anchors, id).
Protein Design Options
--peptide_design: Enable peptide sequence design.
--only_pseudo_sequence_design: Design MHC pseudo-sequence only.
--mhc_design: Design the entire MHC sequence.
--num_sequences_peptide <int>: Number of peptide sequences to generate (default: 10).
--num_sequences_mhc <int>: Number of MHC sequences to generate (default: 10).
--sampling_temp <float>: ProteinMPNN sampling temperature (default: 0.1).
--batch_size <int>: ProteinMPNN batch size (default: 1).
--hot_spot_thr <float>: Distance threshold for MHC hot-spots (default: 6.0).
Advanced Options
--num_templates <int>: Number of templates (default: 4).
--num_recycles <int>: AlphaFold recycles (default: 3).
--models <list>: AlphaFold models (default: ['model_2_ptm']).
--alphafold_param_folder <path>: Path to AlphaFold parameters.
--fine_tuned_model_path <path>: Path to fine-tuned AlphaFold model.
--max_ram <int>: Max RAM per job in GB (default: 3, for parallel mode).
--max_cores <int>: Max CPU cores (default: 4, for parallel mode).
--no_alphafold: Skip AlphaFold modeling.
--only_protein_mpnn: Run ProteinMPNN only on existing structures.
Here are several practical examples to demonstrate how to use PMGen:
Start by setting up your variables:
PEPTIDE='NLVPMVATV'
# MHC-I
MHC_SEQ='AGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGCYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMCAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDA'
HLAALLEL='HLA-B*5301'
DF='data/example/smaller_wrapper_exmaple.tsv'
# MHC-II
MHC_ALPHA_CHAIN_SEQ='IKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNS'
MHC_BETA_CHAIN_SEQ='DTRPRFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVH'
HLAALLEL_II='HLA-DRA*01/HLA-DRB1*0101'
This mode is used when you want to run PMGen for a single model. We recommend to use Wrapper run.
- Running for a Single Model
Model a single pMHC complex with anchor prediction:
python run_PMGen.py \
--mode modeling \
--peptide "$PEPTIDE" \
--mhc_seq "$MHC_SEQ" \
--mhc_type 1 \
--output_dir outputs/basic_mhci \
--predict_anchorReplace MHC_SEQUENCE with your MHC sequence (e.g., from a FASTA file).
Use --mhc_fasta <file> instead of --mhc_seq if providing a FASTA file.
- MHC-II Prediction with manual anchors:
We do not recommend to set --anchors and it is better to predict them.
python run_PMGen.py \
--mode modeling \
--peptide "$PEPTIDE" \
--mhc_seq "$MHC_ALPHA_CHAIN_SEQ/$MHC_BETA_CHAIN_SEQ" \
--mhc_type 2 \
--output_dir outputs/mhcii_manual \
--anchors [2,5,7,9] \
--id "custom_id123"- Using FASTA input with allele name
python run_PMGen.py \
--mode modeling \
--peptide "$PEPTIDE" \
--mhc_fasta mhc_sequence.fasta \
--mhc_type 1 \
--mhc_allele "$HLAALLEL" \
--output_dir outputs/fasta_input \
--predict_anchor
We highly recommed to use a --df path/dataframe as input and run the Wrapper mode. You can run it in two
different ways --run parallel/single. The first runs them in parallel depending on your
defined resources in --max_ram , --max_cores per job. The single mode runs predictions
in a for loop one by one.
You require to make a tab separated dataframe same as below:
id peptide mhc_allele mhc_type anchors
ex1 NLVPMVATV HLA-B*5301 1 1;8
ex2 AAGASSLLL HLA-A*0201 1
ex3 SLLPEPPDAPDAPP HLA-DRB1*04:01 2
ex3 SLLPEPPDAPDAPP HLA-DRB1*04:01 2 2;4;6;9
Empty anchors rows will be predicted.
- Basic wrapper mode (serial execution)
python run_PMGen.py \
--mode wrapper \
--run single \
--df "$DF" \
--output_dir outputs/wrapper_serial \
--num_templates 4 \
--num_recycles 3
- Parallel wrapper execution with multiple models
The valie models are model_1_ptm, model_2_ptm, model_3_ptm, model_4_ptm, model_5_ptm, model_1, model_2, model_3, model_4, model_5 from original alphafold params. If you
want to try a fine-tuned model, you could provide its path e.g
--fine_tuned_model_path AFfine/af_params/params_finetune/params/model_ft_mhc_20640.pkl
and its name --models model_2_ptm_ft. Make sure the name contains _ft so it is
interpreted as fine-tuned model.
python run_PMGen.py \
--mode wrapper \
--run parallel \
--df "$DF" \
--output_dir outputs/wrapper_parallel \
--max_ram 2 \ # GB per job
--max_cores 16 \ # Total cores to use
--num_templates 5 \
--num_recycles 3 \
--models model_2_ptm model_3_ptm
- Memory-intensive parallel run
python run_PMGen.py \
--mode wrapper \
--run parallel \
--df "$DF" \
--output_dir outputs/wrapper_highmem \
--max_ram 2 \
--max_cores 32 \
--num_recycles 6 \
--best_n_templates 4 \
--n_homology_models 2
You can run protein design in both wrapper and single modes. 7. Protein design using a single pMHC:
Enable peptide, MHC, and pseudo-sequence design:
bash
python run_PMGen.py \
--mode modeling \
--peptide "SIINFEKL" \
--mhc_seq "MHC_ALPHA_CHAIN_SEQ/MHC_BETA_CHAIN_SEQ" \
--mhc_type 2 \
--id "design_model" \
--output_dir "output" \
--peptide_design \
--only_pseudo_sequence_design \
--mhc_design \
--num_sequences_peptide 20 \
--num_sequences_mhc 10 \
--sampling_temp 0.2This generates 20 peptide sequences and 10 MHC sequences (full and pseudo).
- Protein Design using TSV file - Large number of sequences:
python run_PMGen.py \
--mode wrapper \
--run single \
--df "data/example/wrapper_input_example.tsv" \
--output_dir wrapper_protdesign \
--num_templates 4 \
--num_recycles 4 \
--peptide_design \
--only_pseudo_sequence_design \
--models model_2_ptm model_1_ptm \
--only_protein_mpnn \
--num_sequences_peptide 100 \
--num_sequences_mhc 50 \
--batch_size 5- Iterative Peptide Generation in Wrapper mode with fixed anchors:
python run_PMGen.py \
--run parallel \
--mode wrapper \
--output_dir outputs/iterative_dataset \
--df "data/example/wrapper_input_example.tsv" \
--peptide_design \
--num_sequences_peptide 10 \
--binder_pred \
--fix_anchors \
--peptide_random_fix_fraction 0 \
--iterative_peptide_gen 50- BioEmu sampling on the final iteration in Iterative Peptide Generation.
python run_PMGen.py \
--mode wrapper \
--run single \
--df data/example/bioemu_exmple.tsv \
--no_pandora \
--output_dir outputs/bioemu_mhcreps_forpaper \
--bioemu_batch_size_100 30 \
--iterative_peptide_gen 5 \
--return_all_outputs \
--fix_anchors \
--peptide_random_fix_fraction 0.6 \
--batch_size 2 \
--peptide_design \
--binder_pred \
--bioemu_run_on_iter 5 \
--run_bioemuResults are saved in --output_dir with the following structure:
output/pandora/: Template structures from PANDORA.
output/alignment/: Alignment files for AlphaFold.
output/alphafold/: AlphaFold-predicted PDB files.
output/protienmpnn/: ProteinMPNN-designed sequences (if enabled).
Each subdirectory is organized by the id provided.
GPU Not Found: Ensure CUDA is installed (conda install -c nvidia cuda-nvcc) and your GPU is compatible.
Memory Errors: Reduce --max_ram or --max_cores to match your system's capacity.
Missing NetMHCpan: Set its path in user_setting.py for anchor prediction, check installation and check tcsh installation.
Installation Issues: Check the Conda environment and rerun install.sh.
PANDORA Errors: check output/pandora/id/pandora.log files.
Alphafold Errors: Mostly relevant to GPU and Jax configuration. Adjust them based on your system.
ProteinMPNN Errors: biopython, pytorch relavent.
For additional help, file an issue at GitHub.
"1. PANDORA - GitHub: https://github.com/X-lab-3D/PANDORA"
" Paper: https://www.frontiersin.org/articles/10.3389/fimmu.2022.878762/full"
"2. AFfine - GitHub: https://github.com/phbradley/alphafold_finetune"
" Paper: https://www.pnas.org/doi/abs/10.1073/pnas.2216697120"
"3. Modeller - Website: https://salilab.org/modeller/"
" Paper: A. Fiser, R.K. Do, & A. Sali. Modeling of loops in protein structures, Protein Science 9. 1753-1773, 2000."
"4. AlphaFold - GitHub: https://github.com/google-deepmind/alphafold"
" Paper: https://www.nature.com/articles/s41586-021-03819-2"
"5. ProteinMPNN - Github https://github.com/dauparas/ProteinMPNN"
" Paper: https://www.science.org/doi/10.1126/science.add2187"